PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 265aa    MW: 30625.7 Da    PI: 4.8345
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018545genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +v q+G ++W+  ++   + R++k+c++rw++yl
      Lus10018545 14 KGTWTPEEDRKLAAYVFQYGCKNWRQLPKAARLARCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding48.32.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++TteE   lv + + lG++ W+ Ia +++ gRt+ ++k++w++yl
      Lus10018545  67 RGNFTTEERASLVALRESLGNK-WSVIATHLP-GRTDSEIKNYWNTYL 112
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.242961IPR017930Myb domain
SuperFamilySSF466891.08E-2612108IPR009057Homeodomain-like
SMARTSM007172.1E-81363IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-221568IPR009057Homeodomain-like
CDDcd001678.30E-101661No hitNo description
PfamPF139211.4E-141776No hitNo description
PROSITE profilePS5129420.55562116IPR017930Myb domain
SMARTSM007171.9E-1466114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2269114IPR009057Homeodomain-like
CDDcd001677.89E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MARTRYVDRN GLTKGTWTPE EDRKLAAYVF QYGCKNWRQL PKAARLARCG KSCRLRWLNY  60
LCPDIKRGNF TTEERASLVA LRESLGNKWS VIATHLPGRT DSEIKNYWNT YLKPRPEAKS  120
VLDPPHVHPT NILDNENIVP YTDISDREQQ ETNSTLTQTY QSNHEMITTV HGEDQSLDQM  180
VAGGNYSDAS AWSDQSTVTN DRHEFVDDDL IGDDFWSKSF LTDYGGDHDQ YYTAMQSEIY  240
GTDDEFQLAK DTLWLDYELN YRYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25121135105B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.16e-49myb domain protein 15